DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and olig4

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001039180.1 Gene:olig4 / 734024 XenbaseID:XB-GENE-484736 Length:209 Species:Xenopus tropicalis


Alignment Length:159 Identity:53/159 - (33%)
Similarity:69/159 - (43%) Gaps:40/159 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNERERMR 168
            ||....||||:                          |.:|.   |..:.::..||:.|.|||.|
 Frog    35 GQRMPPRGRVK--------------------------AGKRE---LTQENQHELRLKVNSRERQR 70

  Fly   169 MHSLNDAFQSLREVIP--HVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAAL--ELNSGA 229
            ||.||.|...||||:|  |....|:||||.||.||:|||     ::||...||...|  |:....
 Frog    71 MHDLNQAMDGLREVMPYSHGPSVRKLSKISTLILARNYI-----VMLSNSLEEMKRLVNEVYGAQ 130

  Fly   230 VGGVLLSNLSSE--SGGPVASGIPANSNA 256
            ......|:||:.  ...||...:||:..|
 Frog   131 RAPGCASSLSTRVPQLPPVMPTVPASDYA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/55 (55%)
olig4NP_001039180.1 bHLH_TS_OLIG2_like 59..121 CDD:381568 34/66 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.