DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and msgn1

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001039104.1 Gene:msgn1 / 733924 XenbaseID:XB-GENE-972085 Length:172 Species:Xenopus tropicalis


Alignment Length:218 Identity:58/218 - (26%)
Similarity:84/218 - (38%) Gaps:69/218 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LQHQLHHNNNNYNTDGHNGLSSESAEGSSRPVRRATRRTSQLSNN--TYDLEMTDS--------S 72
            |.|.|....::|      .|||:|...||     ....|....||  .|.|..|.|        |
 Frog     4 LHHPLVKMEDDY------ALSSDSEPNSS-----CMASTWDWKNNDERYSLSQTPSPQSLSPAVS 57

  Fly    73 SQSDDTSGGGGSSNGGG------STTNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTS 131
            .:|..:|    ||:..|      |.:...:||.|.      ...|.:.:...|..||.       
 Frog    58 YESPYSS----SSHTQGLEEMPFSYSLLQYPSLCH------GDNGDLTKKDHGHKPSM------- 105

  Fly   132 SNSSNANGNASRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERR--LSK 194
                    ...||||              ::|||::||.::.:|..:||..:|.:..:.|  |:|
 Frog   106 --------TVQRRRK--------------ASEREKLRMRAIAEALHTLRNNLPPMYSQGRQPLTK 148

  Fly   195 IETLTLAKNYIINLTHII-LSKR 216
            |:||....|||..||::: .|||
 Frog   149 IQTLKCTINYISELTNLLQCSKR 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 18/55 (33%)
msgn1NP_001039104.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 22/79 (28%)
bHLH_TS_Msgn1 102..167 CDD:381509 26/93 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.