DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Msgn1

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001103021.1 Gene:Msgn1 / 689864 RGDID:1587516 Length:187 Species:Rattus norvegicus


Alignment Length:189 Identity:52/189 - (27%)
Similarity:80/189 - (42%) Gaps:36/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NGLSSESAEG---------SSRPVRRATRRTSQLSNNTYDLEMTDSSSQSDDTSGGGGSSNGGGS 90
            :||.|....|         .:||:.......:|..:....||   |.|:.....|..|:|. |||
  Rat    13 DGLDSSDTTGLLASWDWKSRARPLELIQASPTQSLSPVPSLE---SYSEVALPCGHSGAST-GGS 73

  Fly    91 TTNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERN 155
            ...:.|.:|         |...:..:.....||.|          :|.|.. :.:||: ..|...
  Rat    74 DGYSSHEAG---------GLVELDYSMLAFQPSYI----------HAAGGL-KGQKGS-KVKMSV 117

  Fly   156 MRRLESNERERMRMHSLNDAFQSLREVIPHVEMER--RLSKIETLTLAKNYIINLTHII 212
            .||.:::|||::||.:|.||..:||..:|.|..:|  .|:||:||.....||..||.::
  Rat   118 QRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIRELTDLL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 22/55 (40%)
Msgn1NP_001103021.1 HLH 119..173 CDD:278439 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.