DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and TAL2

DIOPT Version :10

Sequence 1:NP_523611.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_005412.1 Gene:TAL2 / 6887 HGNCID:11557 Length:108 Species:Homo sapiens


Alignment Length:102 Identity:32/102 - (31%)
Similarity:49/102 - (48%) Gaps:14/102 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 RRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAA 221
            |::.:|.|||.|..::|.||..||::||....:::|||.|||.||..| ||....:|.:::.:..
Human     3 RKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRY-INFLVKVLGEQSLQQT 66

  Fly   222 ALELNSGAVG-------------GVLLSNLSSESGGP 245
            .:......:|             ..||.|....|.||
Human    67 GVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_523611.1 bHLH_TS_dimmed_like 157..216 CDD:381555 25/58 (43%)
TAL2NP_005412.1 bHLH_TS_TAL2 2..62 CDD:381550 25/59 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..108 6/15 (40%)

Return to query results.
Submit another query.