DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Scx

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001123980.1 Gene:Scx / 680712 RGDID:1588254 Length:209 Species:Rattus norvegicus


Alignment Length:180 Identity:54/180 - (30%)
Similarity:71/180 - (39%) Gaps:52/180 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SQSDDTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNA 137
            |:.:|.   |..|:|........|.:.|.|.|......|| :.|.||..|               
  Rat    24 SEDEDR---GSESSGSDEKPCRVHAARCGLQGARRRAGGR-RAAGSGPGP--------------- 69

  Fly   138 NGNASRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAK 202
            .|...|..:          :|..:|.|||.|.:|:|.||.:||.:||....:|:|||||||.||.
  Rat    70 GGRPGREPR----------QRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLAS 124

  Fly   203 NYIINLTHIILSKRNEEAAALELNSGAVGGVLLSNLSSESGGPVASGIPA 252
            :||.:|                      |.|||...:...|.|..|| ||
  Rat   125 SYISHL----------------------GNVLLVGEACGDGQPCHSG-PA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 26/53 (49%)
ScxNP_001123980.1 bHLH_TS_scleraxis 76..143 CDD:381521 31/98 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.