DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and SCX

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001073983.1 Gene:SCX / 642658 HGNCID:32322 Length:201 Species:Homo sapiens


Alignment Length:197 Identity:56/197 - (28%)
Similarity:72/197 - (36%) Gaps:78/197 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SQSDDTSGGGGSSNGGGSTTNTGHPSGCSL------------GGQGPSGRGRVQQASSGACPSTI 125
            |:.:|.   |..|:|........|.:.|.|            ||.||.||               
Human    23 SEDEDR---GSDSSGSDEKPCRVHAARCGLQGARRRAGGRRAGGGGPGGR--------------- 69

  Fly   126 APNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMER 190
                        .|...|:|..|             |.|||.|.:|:|.||.:||.:||....:|
Human    70 ------------PGREPRQRHTA-------------NARERDRTNSVNTAFTALRTLIPTEPADR 109

  Fly   191 RLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVGGVLLSNLSSESGGPVASGIPANSN 255
            :|||||||.||.:||.:|                      |.|||:..:...|.|..|| ||..:
Human   110 KLSKIETLRLASSYISHL----------------------GNVLLAGEACGDGQPCHSG-PAFFH 151

  Fly   256 AA 257
            ||
Human   152 AA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 25/53 (47%)
SCXNP_001073983.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 24/111 (22%)
bHLH_TS_scleraxis 73..140 CDD:381521 33/101 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 148..177 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.