Sequence 1: | NP_001260674.1 | Gene: | dimm / 35404 | FlyBaseID: | FBgn0023091 | Length: | 390 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001073983.1 | Gene: | SCX / 642658 | HGNCID: | 32322 | Length: | 201 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 56/197 - (28%) |
---|---|---|---|
Similarity: | 72/197 - (36%) | Gaps: | 78/197 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 SQSDDTSGGGGSSNGGGSTTNTGHPSGCSL------------GGQGPSGRGRVQQASSGACPSTI 125
Fly 126 APNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMER 190
Fly 191 RLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVGGVLLSNLSSESGGPVASGIPANSN 255
Fly 256 AA 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dimm | NP_001260674.1 | HLH | 154..208 | CDD:238036 | 25/53 (47%) |
SCX | NP_001073983.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..92 | 24/111 (22%) | |
bHLH_TS_scleraxis | 73..140 | CDD:381521 | 33/101 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 148..177 | 3/6 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |