DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Neurog3

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_067732.1 Gene:Neurog3 / 60329 RGDID:631350 Length:214 Species:Rattus norvegicus


Alignment Length:165 Identity:48/165 - (29%)
Similarity:70/165 - (42%) Gaps:34/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PVRRATRRTSQLSNNTYDLEMTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPSGRGR 112
            |..:.::.|.|......|.|:..|:|.               ..:.|..|..||           
  Rat     9 PTIQVSQETQQPFPGASDHEVLSSNST---------------PPSPTLVPRDCS----------- 47

  Fly   113 VQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQ 177
              :|.:|.|      ..||.......|..:|.:.....:|:|..||.::|:|||.|||:||.|..
  Rat    48 --EAEAGDC------RGTSRKLRARRGGRNRPKSELALSKQRRSRRKKANDRERNRMHNLNSALD 104

  Fly   178 SLREVIPHVEMERRLSKIETLTLAKNYIINLTHII 212
            :||.|:|....:.:|:|||||..|.|||..||..:
  Rat   105 ALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQTL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 27/53 (51%)
Neurog3NP_067732.1 bHLH_TS_NGN3_ATOH5 77..144 CDD:381561 30/63 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.