DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Hand1

DIOPT Version :10

Sequence 1:NP_523611.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_067603.1 Gene:Hand1 / 59112 RGDID:621206 Length:216 Species:Rattus norvegicus


Alignment Length:119 Identity:40/119 - (33%)
Similarity:55/119 - (46%) Gaps:28/119 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 PSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTSSNSS---NANGNASRRRKGALNAKERNMRR 158
            |:|      ||.....|..|:.|       |::..|.|.   .|.|....||||:          
  Rat    57 PAG------GPPPTTAVAAAAYG-------PDARPSQSPGRLEALGGRLPRRKGS---------- 98

  Fly   159 LESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHII 212
              ..::||.|..|:|.||..|||.||:|..:.:||||:||.||.:||..|..::
  Rat    99 --GPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_523611.1 bHLH_TS_dimmed_like 157..216 CDD:381555 24/56 (43%)
Hand1NP_067603.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..109 13/54 (24%)
bHLH_TS_HAND1 94..153 CDD:381522 28/69 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.