DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and NEUROD4

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_067014.2 Gene:NEUROD4 / 58158 HGNCID:13802 Length:331 Species:Homo sapiens


Alignment Length:255 Identity:67/255 - (26%)
Similarity:101/255 - (39%) Gaps:47/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GSTTNTGHPSGCSLGGQGPSGRGRVQQASSGACPS-TIAPNSTSSNSSNANGNASRRRKGALNAK 152
            |...||.......||.|........:..:.|...| |...:|..............:|:|....|
Human    12 GELVNTPSWMDKGLGSQNEVKEEESRPGTYGMLSSLTEEHDSIEEEEEEEEDGEKPKRRGPKKKK 76

  Fly   153 ------ER-NMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTH 210
                  || ..||:::|.|||.|||.||||..:||.|:|.....::|||||||.||:|||..|:.
Human    77 MTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSE 141

  Fly   211 IILSKRNEEAAAL---------ELNSGAVGGVLLSNLSSESGGPVASGIPANSNAATICFEDTLA 266
            ::.:.:..|....         :..|..|.|.|       ..||.:..:..:.:.:.||      
Human   142 VLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCL-------QLGPQSVLLEKHEDKSPIC------ 193

  Fly   267 SGGAFDCAILAATDGSLLN---AATVTTSPAMQSIQSQAIHLQTPMEQ---QQQQASHLP 320
                 |.||      |:.|   .:....||....:::..:||:..:.:   :....||||
Human   194 -----DSAI------SVHNFNYQSPGLPSPPYGHMETHLLHLKPQVFKSLGESSFGSHLP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/54 (56%)
NEUROD4NP_067014.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..80 13/67 (19%)
HLH 88..144 CDD:238036 30/55 (55%)
Neuro_bHLH 146..264 CDD:289310 22/121 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..265
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.