DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and atoh8

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001073460.2 Gene:atoh8 / 561606 ZFINID:ZDB-GENE-061215-7 Length:266 Species:Danio rerio


Alignment Length:176 Identity:42/176 - (23%)
Similarity:70/176 - (39%) Gaps:47/176 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LSSESAEGSSRPVRRATRRTSQLS-NNTYDLEMTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGC 100
            |.|.|.:..:..:.:|:.:.|.|| ...:.||....|.::...:..|||..........|.|||.
Zfish   101 LRSVSEKTVNSKIVQASPQVSVLSAPQVFPLERVVLSQRAASQAPAGGSERAESPRKRAGEPSGV 165

  Fly   101 SLGGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNERE 165
            ....:.      :||.                                        |||.:|.||
Zfish   166 VTEIKA------IQQT----------------------------------------RRLLANARE 184

  Fly   166 RMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHI 211
            |.|:|:::.||::||:.:|.....::|||:..|.:|.|||::|..:
Zfish   185 RTRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLAQL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 22/53 (42%)
atoh8NP_001073460.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..164 5/23 (22%)
Basic motif, degenerate. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 175..188 7/52 (13%)
HLH 176..227 CDD:278439 22/50 (44%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 189..227 14/37 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.