DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and mespb

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001016653.1 Gene:mespb / 549407 XenbaseID:XB-GENE-970939 Length:292 Species:Xenopus tropicalis


Alignment Length:286 Identity:64/286 - (22%)
Similarity:103/286 - (36%) Gaps:95/286 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GHPSGCSLGGQGPSGRGRVQQASSGACP---STIAPNSTSSNSSNANGNASRRRKGALNAKERN- 155
            |:||........|:.    ...|||..|   ..||......|...|.|.|:.:|:|..:..::. 
 Frog    26 GYPSSEGYSSLSPAS----SSDSSGQSPPYMPYIASQEIFVNIPAAYGQAACQRRGLRHDADKRG 86

  Fly   156 ---------MRRLESNERERMRMHSLNDAFQSLREVIPH--VEMERRLSKIETLTLAKNYI---- 205
                     .:|..::|||::||.:|:.|.|:||..:|.  ..:::.|:|||||.|..:||    
 Frog    87 KKNTGKLPYSQRQSASEREKLRMRNLSKALQNLRRYLPPSVAPLDKTLTKIETLQLTISYISHLS 151

  Fly   206 --INLTHIILSKRNEEAAALELNSGAVGGVLLSNLSSESGGPVASGIPANSNAATICFEDTLASG 268
              :.||..||::|.                                 .|.:....:|     .||
 Frog   152 AQLGLTEEILTQRR---------------------------------LAETQRTNLC-----PSG 178

  Fly   269 GAFDCAI-----LAAT-DGSLLNAATVTTSP-------------AMQSIQSQAIHLQTPMEQQQQ 314
              |.|.:     |..| :....|.|...|.|             ..:::..|:  .:||::.:|:
 Frog   179 --FSCCMDPTHRLCTTPEEDHFNPAATPTMPFSEARCYPEPGYHGREAVCQQS--CETPLQLKQE 239

  Fly   315 QAS---------HLPHHQQAMHGHGH 331
            ..|         ..|..||.:.|..|
 Frog   240 ITSPQYADPSTMAKPVRQQCITGLQH 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 21/71 (30%)
mespbNP_001016653.1 HLH 97..150 CDD:278439 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.