DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Olig1

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_058664.2 Gene:Olig1 / 50914 MGIID:1355334 Length:260 Species:Mus musculus


Alignment Length:242 Identity:65/242 - (26%)
Similarity:87/242 - (35%) Gaps:87/242 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 VQQASSGACPSTI-----------------------APNSTSSNSSNA----------------- 137
            :.||...|.|:|:                       .|.|:||:||::                 
Mouse     5 ISQARVNAAPATMLRPQRPGDVQLGASLYELVGYRQPPISSSSSSSSSTASLLPKPAREKAEAPL 69

  Fly   138 ---NGNASRRRKGALNAKERNMR---RLESNERERMRMHSLNDAFQSLREVI-PHVEME------ 189
               .|.|........:|||...:   |.:.|.|||.||..||.|..:||||| |:....      
Mouse    70 AEPRGPAPESGGARADAKEEQQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPG 134

  Fly   190 RRLSKIETLTLAKNYIINLTHIILSKRNEEA------------AALELNSGAVGGVLLSNLSSES 242
            |:||||.||.||:|||:.|...:...|....            |.|.|.:.|.|.|||:      
Mouse   135 RKLSKIATLLLARNYILLLGSSLQELRRALGDGAGPAAPRLLLAGLPLLAAAPGSVLLA------ 193

  Fly   243 GGPVASGIPANSNAATI---------CFEDTLASGGA-----FDCAI 275
              |.|.|.|........         |.:.:|.:|||     ..||:
Mouse   194 --PGAVGPPETLRPTKYLSLALDEPPCGQFSLPAGGAGSPGLCSCAV 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 28/63 (44%)
Olig1NP_058664.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..104 14/61 (23%)
HLH 96..153 CDD:278439 28/56 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.