Sequence 1: | NP_001260674.1 | Gene: | dimm / 35404 | FlyBaseID: | FBgn0023091 | Length: | 390 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_066279.2 | Gene: | NEUROG3 / 50674 | HGNCID: | 13806 | Length: | 214 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 60/201 - (29%) |
---|---|---|---|
Similarity: | 81/201 - (40%) | Gaps: | 40/201 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 SSRPVRRATRRTSQLSNNTYDLEMTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPSG 109
Fly 110 RGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNERERMRMHSLND 174
Fly 175 AFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVGGVLLSNLS 239
Fly 240 SESGGP 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dimm | NP_001260674.1 | HLH | 154..208 | CDD:238036 | 27/53 (51%) |
NEUROG3 | NP_066279.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..98 | 31/125 (25%) | |
HLH | 81..140 | CDD:238036 | 29/59 (49%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3898 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR19290 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |