DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Neurod6

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001102707.1 Gene:Neurod6 / 500137 RGDID:1562793 Length:337 Species:Rattus norvegicus


Alignment Length:206 Identity:61/206 - (29%)
Similarity:80/206 - (38%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 NASRRRKGALNAK------ER-NMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIET 197
            |...||:|....|      || ..||.|:|.|||.|||.||||..:||:|:|.....::||||||
  Rat    71 NGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIET 135

  Fly   198 LTLAKNYIINLTHIILSKRNEEAAALELNSGAVGGVLLSNLSSESGGPVASGIPANSNAATICFE 262
            |.||||||..|:.|:...:..:......|       |...||..:...||..:..|:.:.     
  Rat   136 LRLAKNYIWALSEILRIGKRPDLLTFVQN-------LCKGLSQPTTNLVAGCLQLNARSF----- 188

  Fly   263 DTLASGGAFDCAILAATDGSLLNAATVTTSPAMQSIQSQAIHLQTPMEQQQQQASHLPHHQQAM- 326
             .:..||               .||..|.||                    ....:.|:|...: 
  Rat   189 -LMGQGG---------------EAAHHTRSP--------------------YSTFYPPYHSPELA 217

  Fly   327 --HGHGHLGAS 335
              .|||.|..|
  Rat   218 TPPGHGTLDNS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 32/54 (59%)
Neurod6NP_001102707.1 HLH 100..151 CDD:197674 30/50 (60%)
Neuro_bHLH 153..272 CDD:315246 21/124 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.