DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and NEUROD2

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_006151.3 Gene:NEUROD2 / 4761 HGNCID:7763 Length:382 Species:Homo sapiens


Alignment Length:269 Identity:79/269 - (29%)
Similarity:108/269 - (40%) Gaps:82/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 RRRKGALNAKERN-MRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYII 206
            ::||......||: :||.::|.|||.|||.||.|..:||:|:|.....::|||||||.||||||.
Human   107 KKRKMTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIW 171

  Fly   207 NLTHIILS-KR-------------------NEEAAALELNS-------GAVGGVLLSNLSSESGG 244
            .|:.|:.| ||                   |..|..|:|||       ||.|    :.....|||
Human   172 ALSEILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADG----AGRFHGSGG 232

  Fly   245 PVAS---GIPANSNAATICFEDTLASGG----------------AFDCAILAATDGSLLNAATVT 290
            |.|.   ..|.:..|...|    .|:||                |::....||..|.        
Human   233 PFAMHPYPYPCSRLAGAQC----QAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGG-------- 285

  Fly   291 TSPAMQSIQSQAIHLQTPM-----EQQQQQASHLPHHQQAMHGHGHLGASIQSQQQPSLVLNGTT 350
            .||...|.:.:. .|..|:     ...:|.:|  |.|:::.|...|..|           |.|:.
Human   286 ASPDYNSSEYEG-PLSPPLCLNGNFSLKQDSS--PDHEKSYHYSMHYSA-----------LPGSR 336

  Fly   351 SVGLGIGIG 359
            ..|.|:..|
Human   337 PTGHGLVFG 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/54 (56%)
NEUROD2NP_006151.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..129 7/21 (33%)
bHLH_TS_NeuroD2 88..180 CDD:381563 35/72 (49%)
Nuclear localization signal. /evidence=ECO:0000255 107..113 2/5 (40%)
Neuro_bHLH 180..310 CDD:403655 31/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.