DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and NEUROD1

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_002491.3 Gene:NEUROD1 / 4760 HGNCID:7762 Length:356 Species:Homo sapiens


Alignment Length:208 Identity:60/208 - (28%)
Similarity:80/208 - (38%) Gaps:69/208 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 RRKGALNAK------ER-NMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLA 201
            :|:|....|      || .:||:::|.|||.|||.||.|..:||:|:|.....::|||||||.||
Human    82 KRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLA 146

  Fly   202 KNYIINLTHIILSKRNEEAAALELNSGAVGGVLLSNLSSESGGPVASGIPANSNAATICFEDTLA 266
            ||||..|:.|:.|.::.:                                      .:.|..||.
Human   147 KNYIWALSEILRSGKSPD--------------------------------------LVSFVQTLC 173

  Fly   267 SGGAFDCAILAATDGSL-LNAATVTTSPAMQSIQSQAIHLQTPMEQQQQQASHLPHHQQAMHGHG 330
            .|.:.....|.|  |.| ||..|...                  ||.|....|||....:...|.
Human   174 KGLSQPTTNLVA--GCLQLNPRTFLP------------------EQNQDMPPHLPTASASFPVHP 218

  Fly   331 HLGASIQSQQQPS 343
            :   |.||...||
Human   219 Y---SYQSPGLPS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/54 (56%)
NEUROD1NP_002491.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94 3/11 (27%)
bHLH_TS_NeuroD1 75..160 CDD:381562 36/77 (47%)
Nuclear localization signal. /evidence=ECO:0000255 87..93 1/5 (20%)
Neuro_bHLH 160..284 CDD:403655 23/130 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.