DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and ASCL1

DIOPT Version :10

Sequence 1:NP_523611.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_004307.2 Gene:ASCL1 / 429 HGNCID:738 Length:236 Species:Homo sapiens


Alignment Length:162 Identity:45/162 - (27%)
Similarity:73/162 - (45%) Gaps:30/162 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GHPSGCSLGGQGPSGRGRVQQASSG----ACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERN 155
            |.|||   ||...:.:...:|.||.    .|...:       |.|....:..:::..|:      
Human    72 GQPSG---GGHKSAPKQVKRQRSSSPELMRCKRRL-------NFSGFGYSLPQQQPAAV------ 120

  Fly   156 MRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEA 220
            .||   |||||.|:..:|..|.:|||.:|:....:::||:|||..|..||..|..::   ...:|
Human   121 ARR---NERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLL---DEHDA 179

  Fly   221 AALELNSGAVGGVLLSN----LSSESGGPVAS 248
            .:....:|.:...:..|    |:|.:|.||:|
Human   180 VSAAFQAGVLSPTISPNYSNDLNSMAGSPVSS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_523611.1 bHLH_TS_dimmed_like 157..216 CDD:381555 23/58 (40%)
ASCL1NP_004307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98 9/28 (32%)
bHLH_TS_ASCL1_Mash1 115..185 CDD:381585 25/81 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.