DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and tap

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster


Alignment Length:267 Identity:71/267 - (26%)
Similarity:96/267 - (35%) Gaps:87/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SGRGRVQQASSGACPSTIAPNSTSSN-SSNANGNASR-RRKGALN-------------AKERNMR 157
            |||..|:..:|.|......|..||:. .|..:.||.| :||.|:.             .|.:..|
  Fly    91 SGRTLVEHLNSRATNGVFDPPLTSTPVKSPEDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRFR 155

  Fly   158 RLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAA 222
            |:::|:|||.|||:||||.:.||..:|.:..|.:|:|||.|..|.|||..|..::.|        
  Fly   156 RMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLES-------- 212

  Fly   223 LELNSGAVGGVLLSNLSSE-------SGGPVASGI------------------PANSNAATICFE 262
                    ||.:  ||..|       ||..:...:                  |.....|.:...
  Fly   213 --------GGSI--NLDLEKLQNFTLSGERITKELFDALFVNPQPYPLFGRMFPYGQGMAPLAQH 267

  Fly   263 DTLASGGAFDCAILAATDGSLLNAATVTTSPAMQSIQSQAIHLQTP----------MEQQQQQAS 317
            .|..                   |:.....|||...|....:.|.|          ...||||..
  Fly   268 QTAP-------------------ASHAEQPPAMGGFQHGMDYPQQPPGFDFTGSMRFYHQQQQQP 313

  Fly   318 HLPHHQQ 324
            |.|||.|
  Fly   314 HQPHHLQ 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 26/53 (49%)
tapNP_524124.1 HLH 155..207 CDD:278439 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.