powered by:
Protein Alignment dimm and figla
DIOPT Version :9
Sequence 1: | NP_001260674.1 |
Gene: | dimm / 35404 |
FlyBaseID: | FBgn0023091 |
Length: | 390 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_944601.2 |
Gene: | figla / 387259 |
ZFINID: | ZDB-GENE-031121-1 |
Length: | 220 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 26/74 - (35%) |
Similarity: | 43/74 - (58%) |
Gaps: | 2/74 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 157 RRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHII--LSKRNEE 219
||..:|.:||:|:.|||..|..||.::|.:..:|:.||::.|..|..||..|:.:: .|.:..|
Zfish 67 RRQLANAKERLRVRSLNSMFSYLRRIVPVMPRDRKPSKVDMLKAATEYIRLLSAVLNHTSDKGNE 131
Fly 220 AAALELNSG 228
.|.:.|.:|
Zfish 132 NANVFLETG 140
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
dimm | NP_001260674.1 |
HLH |
154..208 |
CDD:238036 |
20/50 (40%) |
figla | NP_944601.2 |
HLH |
67..118 |
CDD:278439 |
20/50 (40%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.