DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and cato

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster


Alignment Length:217 Identity:59/217 - (27%)
Similarity:94/217 - (43%) Gaps:41/217 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSESAEGSSRPVRRATRRTSQLSNNTYDLEMTDSSSQSDDTSGGGGSSN------GGGSTTNTGH 96
            |:...:|||:          .|.:..|:|......|..|...|...|..      .||:.|..  
  Fly     7 SASEEDGSSQ----------YLGSPNYNLTQLPPVSGQDYGQGAFLSPEWQFLDAAGGTQTEL-- 59

  Fly    97 PSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNMRRLES 161
                     ||....:.|...    |.|   ...|::.:.::|..|...:..|:...:..||..:
  Fly    60 ---------GPIMEAQGQHTQ----PQT---KRRSNSFTGSDGRKSSPEQTNLSPTVQKRRRQAA 108

  Fly   162 NERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNE-EAAALEL 225
            |.|||.||:.||.||:.||||:|...::::|||.|||.:|::||:.|..::.:...| :|||..:
  Fly   109 NARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILALCDLLNNGDVEVDAAAYTI 173

  Fly   226 NSGAVGGVLLSNLSSESGGPVA 247
            ...:..|..|      |||.::
  Fly   174 FGDSDSGFGL------SGGSLS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 26/53 (49%)
catoNP_477344.1 HLH 104..155 CDD:278439 26/50 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.