DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Ferd3l

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001102450.1 Gene:Ferd3l / 366598 RGDID:1311812 Length:166 Species:Rattus norvegicus


Alignment Length:153 Identity:47/153 - (30%)
Similarity:66/153 - (43%) Gaps:28/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 STTNTGHPSGC-----------SLGGQGPSG----RGRVQQASSGACPSTIAPNSTSSNSSNANG 139
            |..:..||..|           :||.:...|    .||.|:...|    .:.............|
  Rat    21 SLASPRHPFLCEFPPGVPFEDQTLGFREGRGLLQFEGRYQEVEGG----EVDYEDPEEEEEEGEG 81

  Fly   140 NASRRRKGALNAKERNMR------RLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETL 198
               |.|..:|..:.:..|      |..:|.|||.||.:||:||..||..:|....|:|||:||||
  Rat    82 ---RGRVASLLGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETL 143

  Fly   199 TLAKNYIINLTHIILSKRNEEAA 221
            .||..||..:|.::.||..:||:
  Rat   144 RLAIVYISFMTELLQSKEEKEAS 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 27/59 (46%)
Ferd3lNP_001102450.1 HLH 102..154 CDD:278439 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.