DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Bhlhe22

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001102410.1 Gene:Bhlhe22 / 365748 RGDID:1305451 Length:352 Species:Rattus norvegicus


Alignment Length:289 Identity:82/289 - (28%)
Similarity:106/289 - (36%) Gaps:100/289 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GGGGSSNGG--------GSTTNTGHPSGCSLG---------GQGPSGRGRVQQASSG-------- 119
            ||||:|.||        ||....|.||..||.         |:. :|||.|.::|.|        
  Rat    81 GGGGASGGGVSVPGLLVGSAGVGGEPSLSSLPAGAALCLKYGES-AGRGSVAESSGGEQSPDDDS 144

  Fly   120 ----------------ACP---------------------STIAPNS-TSSNSSNANGNASRRRK 146
                            |.|                     |.:.|.. ||.:..|..|.:|::  
  Rat   145 DGRCELVLRAGGPDPRASPGAGSGGAKVAEGCSNAHLHGGSGLPPGGPTSGSGGNGGGGSSKK-- 207

  Fly   147 GALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIP--HVEMERRLSKIETLTLAKNYIINLT 209
                :||:...||..|.|||.|||.||||...||.|||  |....|:||||.||.||||||:...
  Rat   208 ----SKEQKALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILMQA 268

  Fly   210 HIILSKR--------NEEAAALELNSGAVGGVLLSNL-------SSESGGPVASGIPANSNAATI 259
            ..:...|        .:..:|..|.|.|......:.|       ...:|.|.::|:|    .|..
  Rat   269 QALEEMRRLVAYLNQGQAISAASLPSSAAAAAAAAALHPALGAYEQAAGYPFSAGLP----PAAS 329

  Fly   260 CFEDTLASGGAFDCAILAATDGSLLNAAT 288
            |.|         .||:..:...||....|
  Rat   330 CPE---------KCALFNSVSSSLCKQCT 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 32/55 (58%)
Bhlhe22NP_001102410.1 HLH 219..273 CDD:197674 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.