DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Bhlha9

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_038943763.1 Gene:Bhlha9 / 363656 RGDID:1311234 Length:230 Species:Rattus norvegicus


Alignment Length:260 Identity:65/260 - (25%)
Similarity:94/260 - (36%) Gaps:70/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TSGGG--GSSNGGGSTTNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGN 140
            |.|.|  |...|..|..:.||  .|...|:           :.|....::|.....         
  Rat     5 TPGLGLRGLKRGEDSVGDLGH--SCPEAGR-----------NFGVLRRSLAEEEEV--------- 47

  Fly   141 ASRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYI 205
            |.|:|:....:|   .||:.:|.|||.|:...|:||.:||..:.|....:|||||.||..|   |
  Rat    48 AGRKRERPARSK---ARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKIATLRRA---I 106

  Fly   206 INLTHIILSKRNEEA-----AALELNSGAVGGVLLSNLSSESGGPVASGI--PANSNAATICFED 263
            ..:|.:.|..|...|     ..||.:..|..|    :.:.:||..|...:  ||   |.::...|
  Rat   107 HRITALSLVLRASPAPRWPCGHLECHGQAAHG----SSAGDSGFSVPRSVLSPA---APSLARRD 164

  Fly   264 TLASGGAFDCAILAATDGSLLNAATVTTSPAMQSIQSQAIHLQTPMEQQQQQASHLPHHQQAMHG 328
            |.                    :..|..:|...|....| ||..|     :..:.:|...||..|
  Rat   165 TA--------------------SPLVPPAPRCASCSPNA-HLGRP-----RMMAEVPSLAQASGG 203

  Fly   329  328
              Rat   204  203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 22/53 (42%)
Bhlha9XP_038943763.1 bHLH_TS_bHLHa9 54..116 CDD:381482 25/67 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.