DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and amos

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster


Alignment Length:218 Identity:61/218 - (27%)
Similarity:97/218 - (44%) Gaps:46/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DATQLTELMGSHDFMQLQ---HQLHHNNNNYNTDGHNGLSSESAEGSSRPVRRATRRTSQLSNNT 63
            :|..:.|.:.:..|.||:   :|...:.::..:||.|..|.|....:.               :.
  Fly    16 EAPAIPEFLSNDTFQQLEQLMYQQEFSTSDSQSDGANSCSLEMYYDTP---------------SV 65

  Fly    64 YDLE-MTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCSLG---GQGPSGRGRVQQASSGACPST 124
            .:|| |.::..|...                  |.....||   |:.|....:.|::......||
  Fly    66 LELEHMLNAQEQQQH------------------HLQANPLGKNQGRSPRYWNKQQRSKPYDKLST 112

  Fly   125 IAPNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEME 189
            ...:||||.||:::.:|      ....:....|||.:|.|||.||:||||||..||:|:|.:..:
  Fly   113 SMSSSTSSASSSSSSSA------GFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHD 171

  Fly   190 RRLSKIETLTLAKNYIINLTHII 212
            |||||.|||.:|:.||.:|..::
  Fly   172 RRLSKYETLQMAQAYIGDLVTLL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/53 (57%)
amosNP_477446.1 HLH 137..195 CDD:238036 31/58 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.