DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Oli

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster


Alignment Length:228 Identity:65/228 - (28%)
Similarity:84/228 - (36%) Gaps:92/228 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 NTGH----PSGCSLGGQGPS---------------------------GRGRVQQ----------- 115
            |.||    |:...||||.|:                           |.|..||           
  Fly    15 NHGHMPIPPTANMLGGQHPAPTASPPQSVPGRRTPLGSVGLGGFYAQGMGMSQQPPTDENKPGPS 79

  Fly   116 ----------------ASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNER 164
                            |.||. .:|:|.:|..::.|.:|....:.|:|       ...||..|.|
  Fly    80 APEKPLSPTAAAIAAIAISGG-TTTVAVSSGGASGSGSNSGKQKNRQG-------KTVRLNINAR 136

  Fly   165 ERMRMHSLNDAFQSLREVIP--HVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNS 227
            ||.|||.||||...||.|||  |....|:||||.||.||||||:          .::.|..||..
  Fly   137 ERRRMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYIL----------MQQNALEELRR 191

  Fly   228 GAVGGVLLSNLSSESGG--------PVASGIPA 252
                  ||:.:.|.:|.        |.|:.:.|
  Fly   192 ------LLAYIQSTTGAAPLDLGAFPAAAKLQA 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 32/55 (58%)
OliNP_001188830.1 HLH 134..188 CDD:197674 31/63 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446161
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.