DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and MSGN1

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001099039.1 Gene:MSGN1 / 343930 HGNCID:14907 Length:193 Species:Homo sapiens


Alignment Length:212 Identity:56/212 - (26%)
Similarity:89/212 - (41%) Gaps:35/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FMQLQHQLHHNNNNYNTDGHNGLSSESAEGSSRPVRRATRRTSQLSNNTYDLEMTDSSSQSDDTS 79
            |:.|:..|.      ::|....|||...:..:.|........||..:....|| :.|||.....:
Human     8 FLSLEDGLG------SSDSPGLLSSWDWKDRAGPFELNQASPSQSLSPAPSLE-SYSSSPCPAVA 65

  Fly    80 G----GGGSSNGGGSTTNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGN 140
            |    .||:|:||.        .|||:||    ..|.|:          :..|..:...::..|.
Human    66 GLPCEHGGASSGGS--------EGCSVGG----ASGLVE----------VDYNMLAFQPTHLQGG 108

  Fly   141 ASRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMER--RLSKIETLTLAKN 203
            ...:.:.....:....||.:::|||::||.:|.||..:||..:|.|..:|  .|:||:||.....
Human   109 GGPKAQKGTKVRMSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIK 173

  Fly   204 YIINLTHIILSKRNEEA 220
            ||..||.::...|...|
Human   174 YIGELTDLLNRGREPRA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 22/55 (40%)
MSGN1NP_001099039.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..59 6/25 (24%)
HLH 125..179 CDD:278439 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.