DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and olig4

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_955808.1 Gene:olig4 / 324857 ZFINID:ZDB-GENE-030131-3580 Length:244 Species:Danio rerio


Alignment Length:217 Identity:64/217 - (29%)
Similarity:91/217 - (41%) Gaps:39/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SSGACPSTIAPNST------SSNSSNANGNASRRR--KGALNAKERNMR-----------RLESN 162
            :|..|..:.:|:.|      |:....|.|...:::  ||..||.:...|           ||:.|
Zfish     5 ASSTCSRSSSPDLTVDSGFFSNKMFQAYGETVQQKSEKGLQNAGKTRTRADLSKDDLQDLRLKVN 69

  Fly   163 ERERMRMHSLNDAFQSLREVIPHVE--MERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALEL 225
            .|||.|||.||.|...||||:|:.:  ..|:||||.||.||:|||     ::||...||...|  
Zfish    70 SRERKRMHDLNQAMDGLREVMPYAQGPSVRKLSKISTLLLARNYI-----LMLSSSLEEMKKL-- 127

  Fly   226 NSGAVGGVLLSNLSSESGG---PVASGIPANSNAATICFEDTLASGGAFDCAILAATDGSLLNAA 287
                ||.|..:|..|.|..   |..|..||................|:........|:|:....:
Zfish   128 ----VGDVYGANAQSHSARRVLPPTSAAPATQLPLLSLAPSLHPLVGSTSAVSHTTTNGAQTPHS 188

  Fly   288 TVTTS----PAMQSIQSQAIHL 305
            ..:|.    ||:.::....:||
Zfish   189 PPSTGYLGFPALPTLLKDPLHL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/66 (45%)
olig4NP_955808.1 HLH 69..123 CDD:197674 29/58 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.