DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and bhlha9

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001189344.1 Gene:bhlha9 / 323481 ZFINID:ZDB-GENE-030131-2201 Length:260 Species:Danio rerio


Alignment Length:282 Identity:66/282 - (23%)
Similarity:95/282 - (33%) Gaps:88/282 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 PSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRK--------GALNAKERNM------- 156
            |:...|...||.|        :.|.|..|....:.|.:..        |.||..|..:       
Zfish     3 PASVCRFSMASRG--------SFTGSEFSEEEPDGSLQESELDSSDGLGGLNEPEERLIKKRSRP 59

  Fly   157 -----RRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKR 216
                 ||:.:|.|||.|:...|.||.:||..:.|....:|||||.||..|.|.|           
Zfish    60 VRSKARRVAANVRERKRILDYNQAFNALRVALHHDLSGKRLSKIATLQRAINRI----------- 113

  Fly   217 NEEAAALELNSGAVGGVL--LSNLSSESGGPVASGIPANSNAAT---------------ICFEDT 264
              .|.::.|.:....||.  ..:|..:.||..|...|:..|..|               :..|..
Zfish   114 --SALSVFLTNNPPVGVAKPCGHLECQPGGLWAEAEPSMQNFLTWHQPLNQHLQTSIHRLSSEQH 176

  Fly   265 LASGGA------FDCAILAATDGSLLNAATVTTSPAMQSIQSQAIHLQTPMEQQQQQASHLPHHQ 323
            :.:|.|      :.|   .:.|..|..||:|.:.|....|                  ..:..:|
Zfish   177 VFTGPACPPSPHYPC---FSPDNQLYPAASVPSPPRYGRI------------------GDVGAYQ 220

  Fly   324 QAMHGHGH---LGASIQSQQQP 342
            |.:.|..|   .|.|:|:...|
Zfish   221 QGVWGGNHADGYGESLQTLPLP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 23/65 (35%)
bhlha9NP_001189344.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..49 7/31 (23%)
HLH 65..116 CDD:278439 23/63 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.