DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and HLH4C

DIOPT Version :10

Sequence 1:NP_523611.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:108 Identity:31/108 - (28%)
Similarity:53/108 - (49%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PSTIAPNSTSSNSSNAN-------GNASRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQSL 179
            |.|.||...::..::.:       ....|||:.....|.|....    .|||:|:.:.|.:|..|
  Fly    71 PPTPAPRRRTTPIAHLDPSELVGLSREERRRRRRATLKYRTAHA----TRERIRVEAFNVSFAEL 131

  Fly   180 REVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAA 222
            |:::|.:..:::|||||.|.||..||..|.|::.:. :...|:
  Fly   132 RKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLETPXDSAGAS 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_523611.1 bHLH_TS_dimmed_like 157..216 CDD:381555 21/58 (36%)
HLH4CNP_001259243.1 bHLH_TS_HEN1 105..165 CDD:381544 23/63 (37%)

Return to query results.
Submit another query.