DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Lyl1

DIOPT Version :10

Sequence 1:NP_523611.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001007678.1 Gene:Lyl1 / 304663 RGDID:1359244 Length:278 Species:Rattus norvegicus


Alignment Length:170 Identity:51/170 - (30%)
Similarity:74/170 - (43%) Gaps:33/170 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GGSTTNTGH--PSGCS-----LGGQGPSGRGRVQQASSGACPSTIA----PNSTSSN-------- 133
            |....|.||  |:|.:     |....||   .:|.|:.|..|.|:|    |:...::        
  Rat    58 GVPVINLGHTRPTGAAMPTTELSAFRPS---LLQLAALGTAPPTLALHYHPHPFLNSVYIGPAGP 119

  Fly   134 -SSNANGNASRR-RKGAL-----NAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERR 191
             |...|....|| ..|.|     :..::..||:.:|.|||.|...:|.||..||:::|....:|:
  Rat   120 FSIFPNSRLKRRPSHGELDLVDGHQPQKVARRVFTNSRERWRQQHVNGAFAELRKLLPTHPPDRK 184

  Fly   192 LSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVG 231
            |||.|.|.||..||..|..::    .::||.|.....|.|
  Rat   185 LSKNEVLRLAMKYIGFLVRLL----RDQAAVLASGPSAPG 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_523611.1 bHLH_TS_dimmed_like 157..216 CDD:381555 24/58 (41%)
Lyl1NP_001007678.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
bHLH_TS_LYL1 145..209 CDD:381548 24/67 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..278 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.