DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Olig2

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001094027.1 Gene:Olig2 / 304103 RGDID:1307098 Length:323 Species:Rattus norvegicus


Alignment Length:272 Identity:84/272 - (30%)
Similarity:119/272 - (43%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LSSESAEGSSRPVRRATRRTSQLSNNTYDLEMTDSSSQSDD-----TSGGGGSSNGGGSTTNTGH 96
            :.|:::..||||                      ||.:.||     .|.||.||...|.|.::..
  Rat     1 MDSDASLVSSRP----------------------SSPEPDDLFLPARSKGGSSSGFTGGTVSSST 43

  Fly    97 PSGCS-------LGGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKER 154
            ||.|.       .|..|.:|.....:...|...|  :.:||||::|:|..:::::.|..:...|.
  Rat    44 PSDCPPELSSELRGAMGTAGAHPGDKLGGGGFKS--SSSSTSSSTSSAATSSTKKDKKQMTEPEL 106

  Fly   155 NMRRLESNERERMRMHSLNDAFQSLREVIP--HVEMERRLSKIETLTLAKNYIINLTHIILSKRN 217
            ...||:.|.|||.|||.||.|...||||:|  |....|:||||.||.||:|||:.||:.:     
  Rat   107 QQLRLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSL----- 166

  Fly   218 EEAAAL--ELNSG--------AVGGVLLSN-LSSESGGPVASGIPANSNAATICFEDTLASGGAF 271
            ||...|  |:..|        |.||:..|. |.:.:..|.|:...|:..|.........|:..|.
  Rat   167 EEMKRLVSEIYGGHHAGFHPSACGGLAHSTPLPTATAHPAAAAHAAHHPAVHHPILPPAAAAAAA 231

  Fly   272 DCAILAATDGSL 283
            ..|..|.:..||
  Rat   232 AAAAAAVSSASL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/55 (55%)
Olig2NP_001094027.1 bHLH_TS_OLIG2 95..179 CDD:381510 38/88 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5079
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.