DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and neurod1

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_571053.1 Gene:neurod1 / 30169 ZFINID:ZDB-GENE-990415-172 Length:350 Species:Danio rerio


Alignment Length:356 Identity:82/356 - (23%)
Similarity:125/356 - (35%) Gaps:122/356 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 MTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTSS 132
            |.:|.|.|:.|.....||........|..|....:.....:|..|::.           .:....
Zfish    11 MLESQSSSNWTDKCHSSSQDERDVDKTSEPMLNDMEDDDDAGLNRLED-----------EDDEEE 64

  Fly   133 NSSNANGNASR-RRKGALNAK------ER-NMRRLESNERERMRMHSLNDAFQSLREVIPHVEME 189
            .....:|:.:: :|:|....|      :| .|||:::|.|||.|||.||||.:|||:|:|.....
Zfish    65 EEEEEDGDDTKPKRRGPKKKKMTKARMQRFKMRRMKANARERNRMHGLNDALESLRKVVPCYSKT 129

  Fly   190 RRLSKIETLTLAKNYIINLTHIILSKRNEE--------------------AAALELN-------- 226
            ::|||||||.||||||..|:.|:.|.::.:                    |..|:||        
Zfish   130 QKLSKIETLRLAKNYIWALSEILRSGKSPDLMSFVQALCKGLSQPTTNLVAGCLQLNPRTFLPEQ 194

  Fly   227 --------------------------------------------SGAVGGVL-------LSNLSS 240
                                                        ..|.|..|       |::.:|
Zfish   195 SQEMPPHMQTASASFSALPYSYQTPGLPSPPYGTMDSSHIFHVKPHAYGSALEPFFDTTLTDCTS 259

  Fly   241 ES-GGPVASGIPANSNAA-----TICFEDTLASGGAFDCAILAATDG---SLLNAATVTTSPAMQ 296
            .| .||::..:..|.|.:     :..||...|....:..|.||...|   ||...:|......|:
Zfish   260 PSFDGPLSPPLSVNGNFSFKHEPSSEFEKNYAFTMHYQAAGLAGAQGHAASLYAGSTQRCDIPME 324

  Fly   297 SIQSQAIHLQTPMEQQQQQASHLPHHQQAMH 327
            :|.|...|               .||::.|:
Zfish   325 NIMSYDGH---------------SHHERVMN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 33/54 (61%)
neurod1NP_571053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 15/90 (17%)
Nuclear localization signal. /evidence=ECO:0000255 82..88 1/5 (20%)
HLH 95..153 CDD:238036 34/57 (60%)
Neuro_bHLH 155..277 CDD:289310 14/121 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.