DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Olig3

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001099739.1 Gene:Olig3 / 293012 RGDID:1305997 Length:273 Species:Rattus norvegicus


Alignment Length:208 Identity:66/208 - (31%)
Similarity:96/208 - (46%) Gaps:40/208 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RVQQASS--GACPSTIAPNSTSSNSSNANGNASRRR-KGALNAKERNMRRLESNERERMRMHSLN 173
            |:...||  |.....:...|.|...:.|.|.:|:.: |..|:.::....||:.|.|||.|||.||
  Rat    37 RLNSVSSTQGDMVQKMPGESLSRAGAKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLN 101

  Fly   174 DAFQSLREVIP--HVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVGGVLLS 236
            .|...||||:|  |....|:||||.||.||:|||:.||           ::||.....||.:...
  Rat   102 LAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLT-----------SSLEEMKRLVGEIYGG 155

  Fly   237 NLSSESGGPV--ASGIPANSNAATICFEDTLASGGAFDCAILAATDGSLLNAATV---------- 289
            :.|:...|.|  ::|.||::..|.......|  ||    |:.:....|.|:||::          
  Rat   156 HHSAFHCGTVGHSAGHPAHAANAVHPVHPIL--GG----ALSSGNASSPLSAASLPTIGTIRPPH 214

  Fly   290 ------TTSPAMQ 296
                  :|.||:|
  Rat   215 SLLKAPSTPPALQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/55 (55%)
Olig3NP_001099739.1 bHLH_TS_OLIG3 70..150 CDD:381511 36/90 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5079
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.