DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Neurod4

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001099412.2 Gene:Neurod4 / 288821 RGDID:1310434 Length:330 Species:Rattus norvegicus


Alignment Length:260 Identity:63/260 - (24%)
Similarity:103/260 - (39%) Gaps:95/260 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 NGNASRRRKGALNAKERNM----------RRLESNERERMRMHSLNDAFQSLREVIPHVEMERRL 192
            :|:..:||    ..|::.|          ||:::|.|||.|||.||||..:||.|:|.....::|
  Rat    63 DGDKPKRR----GPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKL 123

  Fly   193 SKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVGGVLLSNLSSESG---------GPVAS 248
            ||||||.||:|||..|:.::     |....|| ..|.| .:|...||..:.         ||.::
  Rat   124 SKIETLRLARNYIWALSEVL-----ETGQTLE-GKGFV-EMLCKGLSQPTSNLVAGCLQLGPQSA 181

  Fly   249 GIPANSNAATICFEDTLASGGAFDCAILAATDGSLLNAATVTTSPAMQS-----IQSQAIHLQ-- 306
            .:......:.||  |:..|..:|:                 ..||.:.|     :::..:||:  
  Rat   182 LLEKREEKSPIC--DSTVSVHSFN-----------------YQSPGLPSPPYGHMETHPLHLKPQ 227

  Fly   307 -------------------------TP---------MEQQ-----QQQASHLPHHQQAMHGHGHL 332
                                     ||         ::|:     ::..:.:||:..|....||:
  Rat   228 PFKSLGDSFGSHPPDCSTPPYEGPLTPPLSISGNFSLKQEGSPDLEKSYNFMPHYTSASVSSGHV 292

  Fly   333  332
              Rat   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/63 (48%)
Neurod4NP_001099412.2 bHLH_TS_NeuroD4_ATOH3 59..145 CDD:381564 35/90 (39%)
Neuro_bHLH 146..263 CDD:403655 21/137 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.