DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and BHLHE22

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_689627.1 Gene:BHLHE22 / 27319 HGNCID:11963 Length:381 Species:Homo sapiens


Alignment Length:279 Identity:81/279 - (29%)
Similarity:114/279 - (40%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YNTDGHNGLSSESAEGSSRPVRRATRRTSQLSNNTYDLEMTDSSSQSDDTSGGGGSSNGGGSTTN 93
            |......|..:||:.|...|...:..|...:      |....:..::...:||||:....|.:..
Human   129 YGESASRGSVAESSGGEQSPDDDSDGRCELV------LRAGVADPRASPGAGGGGAKAAEGCSNA 187

  Fly    94 TGHPSGCSL--GGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNM 156
            ..| .|.|:  ||.|..|.|.....|||....:   .|.|..||:::.::|::      :||:..
Human   188 HLH-GGASVPPGGLGGGGGGGSSSGSSGGGGGS---GSGSGGSSSSSSSSSKK------SKEQKA 242

  Fly   157 RRLESNERERMRMHSLNDAFQSLREVIP--HVEMERRLSKIETLTLAKNYIINLTHIILSKR--- 216
            .||..|.|||.|||.||||...||.|||  |....|:||||.||.||||||:.....:...|   
Human   243 LRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLV 307

  Fly   217 -----NEEAAALELNSGAVGGVLLSNL-------SSESGGPVASGIPANSNAATICFEDTLASGG 269
                 .:..:|..|.|.|......:.|       ...:|.|.::|:|    .|..|.|       
Human   308 AYLNQGQAISAASLPSSAAAAAAAAALHPALGAYEQAAGYPFSAGLP----PAASCPE------- 361

  Fly   270 AFDCAILAATDGSLLNAAT 288
              .||:..:...||....|
Human   362 --KCALFNSVSSSLCKQCT 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 32/55 (58%)
BHLHE22NP_689627.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..94
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..154 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..242 18/63 (29%)
HLH 248..302 CDD:197674 30/53 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.