DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and neurod4

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_739568.2 Gene:neurod4 / 266958 ZFINID:ZDB-GENE-030730-1 Length:348 Species:Danio rerio


Alignment Length:190 Identity:58/190 - (30%)
Similarity:83/190 - (43%) Gaps:32/190 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SSNGGGSTTNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGA 148
            ||..|..|...||.|      ...|.||.::..|......   ...........:|..:.:|:|.
Zfish    27 SSQDGDRTPEIGHYS------LHRSNRGPLEIGSEDMDEE---EEEEEDEEMGLDGEKAPKRRGP 82

  Fly   149 LNAK------ER-NMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYII 206
            ...|      || ..||:::|.|||.|||.||||..:||.|:|.....::|||||||.||:|||.
Zfish    83 KKKKMTKARQERFRARRIKANARERSRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIW 147

  Fly   207 NLTHIILSKRNEEAAAL---------ELNSGAVGGVL------LSNLSSESGGPVASGIP 251
            .|:.::.|.::.|:...         :..|..|.|.|      :..|..:.|.| .:|:|
Zfish   148 ALSEVLESGQSPESHGFVEMLCKGLSQPTSNLVAGCLQLGPTTMLKLDEKCGVP-GAGVP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/54 (56%)
neurod4NP_739568.2 HLH 98..154 CDD:238036 30/55 (55%)
Neuro_bHLH 156..272 CDD:289310 10/52 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.