DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Bhlha15

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_036995.1 Gene:Bhlha15 / 25334 RGDID:3091 Length:197 Species:Rattus norvegicus


Alignment Length:130 Identity:64/130 - (49%)
Similarity:82/130 - (63%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNM-RRLESNERER 166
            |.|.|..    .|:.|||...|....|.::.:|......||||:|:.:.:|.:: ||||||||||
  Rat    22 GEQTPDR----SQSGSGASEVTKGLRSRTARASGTRAEVSRRRQGSSSRRENSVQRRLESNERER 82

  Fly   167 MRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVG 231
            .|||.||:|||:||||||||..:::||||||||||||||.:||..||:..:.....||....|.|
  Rat    83 QRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLPGLEAPGPAPG 147

  Fly   232  231
              Rat   148  147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 40/54 (74%)
Bhlha15NP_036995.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 24/63 (38%)
HLH 70..124 CDD:238036 40/53 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..197
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340925
Domainoid 1 1.000 85 1.000 Domainoid score I8043
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005380
OrthoInspector 1 1.000 - - oto98490
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6113
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.