DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and lin-32

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_508410.2 Gene:lin-32 / 191703 WormBaseID:WBGene00003018 Length:142 Species:Caenorhabditis elegans


Alignment Length:141 Identity:45/141 - (31%)
Similarity:69/141 - (48%) Gaps:25/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RGRVQ-------QASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNERERM 167
            :|.:|       |:.:.:..|...|:|.|:.....:....||.| ..:.:...|||..:|||||.
 Worm    20 QGSIQSTMTTPLQSPNFSLDSPNYPDSLSNGGGKDDKKKCRRYK-TPSPQLLRMRRSAANERERR 83

  Fly   168 RMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVGG 232
            ||::||.|:..||||:|.::..::|||.|||.:|:.||..|:.|:......|             
 Worm    84 RMNTLNVAYDELREVLPEIDSGKKLSKFETLQMAQKYIECLSQILKQDSKNE------------- 135

  Fly   233 VLLSNLSSESG 243
                ||.|:||
 Worm   136 ----NLKSKSG 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 27/53 (51%)
lin-32NP_508410.2 HLH 73..124 CDD:278439 26/50 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.