powered by:
Protein Alignment dimm and hlh-8
DIOPT Version :9
Sequence 1: | NP_001260674.1 |
Gene: | dimm / 35404 |
FlyBaseID: | FBgn0023091 |
Length: | 390 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509367.1 |
Gene: | hlh-8 / 181069 |
WormBaseID: | WBGene00001953 |
Length: | 178 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 29/66 - (43%) |
Similarity: | 39/66 - (59%) |
Gaps: | 5/66 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 144 RRKG----ALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNY 204
|||| ..|..|...:|..:|.|||.|...|||||..||::||.:..: ::|||.||.:|.:|
Worm 4 RRKGERVVRKNEVENVQQRACANRRERQRTKELNDAFTLLRKLIPSMPSD-KMSKIHTLRIATDY 67
Fly 205 I 205
|
Worm 68 I 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
dimm | NP_001260674.1 |
HLH |
154..208 |
CDD:238036 |
23/52 (44%) |
hlh-8 | NP_509367.1 |
HLH |
21..71 |
CDD:278439 |
23/49 (47%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.