powered by:
Protein Alignment dimm and Y7A9D.1
DIOPT Version :9
Sequence 1: | NP_001260674.1 |
Gene: | dimm / 35404 |
FlyBaseID: | FBgn0023091 |
Length: | 390 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_502951.1 |
Gene: | Y7A9D.1 / 178455 |
WormBaseID: | WBGene00012420 |
Length: | 115 |
Species: | Caenorhabditis elegans |
Alignment Length: | 53 |
Identity: | 10/53 - (18%) |
Similarity: | 28/53 - (52%) |
Gaps: | 1/53 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 142 SRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHV-EMERRLS 193
||:.:.:.:|:.|...::.:..|:.:......|.::.:...|.|: |::.:|:
Worm 20 SRKIRKSTSAERREKEKVTNRLRQLVAAEEDTDQYELVMATIAHIRELQAQLN 72
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
dimm | NP_001260674.1 |
HLH |
154..208 |
CDD:238036 |
7/41 (17%) |
Y7A9D.1 | NP_502951.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3898 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.