DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Bhlha15

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_034930.1 Gene:Bhlha15 / 17341 MGIID:891976 Length:197 Species:Mus musculus


Alignment Length:188 Identity:76/188 - (40%)
Similarity:91/188 - (48%) Gaps:47/188 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SRPVRRATRRTSQLSNNTYDLEMTDSSSQSD-DTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPSG 109
            :||.||.|        ...|.|.|......| ..||.|||....|..:.|...||         |
Mouse     5 NRPPRRRT--------PMQDTEATPGEQTPDRPQSGSGGSELTKGLRSRTARASG---------G 52

  Fly   110 RGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNM-RRLESNERERMRMHSLN 173
            ||.|                            ||||:|:...:|.:: ||||||||||.|||.||
Mouse    53 RGEV----------------------------SRRRQGSGGRRENSVQRRLESNERERQRMHKLN 89

  Fly   174 DAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVG 231
            :|||:||||||||..:::||||||||||||||.:||..||:..:.....||....|.|
Mouse    90 NAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLPGLEAPGPAPG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 40/54 (74%)
Bhlha15NP_034930.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 36/121 (30%)
HLH 70..124 CDD:238036 40/53 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..197
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837207
Domainoid 1 1.000 85 1.000 Domainoid score I8224
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005380
OrthoInspector 1 1.000 - - oto94995
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4537
SonicParanoid 1 1.000 - - X6113
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.