DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Ascl1

DIOPT Version :10

Sequence 1:NP_523611.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_032579.2 Gene:Ascl1 / 17172 MGIID:96919 Length:231 Species:Mus musculus


Alignment Length:179 Identity:43/179 - (24%)
Similarity:73/179 - (40%) Gaps:27/179 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 TGHPSGCSLGGQGPSGRGRVQQASSGACP--STIAPNSTSSNSSNANGNASRRRKGALNAKERNM 156
            |...:..:......|.:.:..||.....|  |.:|.:..|.....:.....:|::.:.....|..
Mouse    31 TAAAAAAAAAAAAQSAQQQQPQAPPQQAPQLSPVADSQPSGGGHKSAAKQVKRQRSSSPELMRCK 95

  Fly   157 RRL------------------ESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKN 203
            |||                  ..|||||.|:..:|..|.:|||.:|:....:::||:|||..|..
Mouse    96 RRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVE 160

  Fly   204 YIINLTHIILSKRNEEAAALELNSGAVGGVLLSN----LSSESGGPVAS 248
            ||..|..::   ...:|.:....:|.:...:..|    |:|.:|.||:|
Mouse   161 YIRALQQLL---DEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_523611.1 bHLH_TS_dimmed_like 157..216 CDD:381555 24/76 (32%)
Ascl1NP_032579.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..92 8/52 (15%)
bHLH_TS_ASCL1_Mash1 110..180 CDD:381585 22/72 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.