Sequence 1: | NP_001260674.1 | Gene: | dimm / 35404 | FlyBaseID: | FBgn0023091 | Length: | 390 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_786923.1 | Gene: | OLIG3 / 167826 | HGNCID: | 18003 | Length: | 272 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 66/206 - (32%) |
---|---|---|---|
Similarity: | 99/206 - (48%) | Gaps: | 33/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 108 SGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRR-KGALNAKERNMRRLESNERERMRMHS 171
Fly 172 LNDAFQSLREVIP--HVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVGGVL 234
Fly 235 LSNLSSESGGPV--ASGIPANSNAATICFEDTLASGGAFDCAILAATDGSLLNAATVTTSPAMQS 297
Fly 298 IQSQAIHLQTP 308 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dimm | NP_001260674.1 | HLH | 154..208 | CDD:238036 | 30/55 (55%) |
OLIG3 | NP_786923.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..71 | 9/36 (25%) | |
HLH | 85..138 | CDD:306515 | 30/52 (58%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3898 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR19290 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |