DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and TCF23

DIOPT Version :10

Sequence 1:NP_523611.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_786951.1 Gene:TCF23 / 150921 HGNCID:18602 Length:214 Species:Homo sapiens


Alignment Length:127 Identity:38/127 - (29%)
Similarity:55/127 - (43%) Gaps:20/127 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 QGP---SGRGRVQ-QASSGACPSTIAPNSTSSNS---------------SNANGNASRRRKGALN 150
            :||   .|.|..| ||.:...|......|..|.:               |.|.......|.|.| 
Human     7 RGPPAMPGVGHSQTQAKARLLPGADRKRSRLSRTRQDPWEERSWSNQRWSRATPGPRGTRAGGL- 70

  Fly   151 AKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHII 212
            |..|:....|:..|||.|:.:|..||.:|:..:|.|..:.:|||::.|.||.:||.:||..:
Human    71 ALGRSEASPENAARERSRVRTLRQAFLALQAALPAVPPDTKLSKLDVLVLAASYIAHLTRTL 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_523611.1 bHLH_TS_dimmed_like 157..216 CDD:381555 21/56 (38%)
TCF23NP_786951.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 19/79 (24%)
bHLH_SF 78..133 CDD:469605 21/55 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..214
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.