DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Bhlhe23

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_542372.2 Gene:Bhlhe23 / 140489 MGIID:2153710 Length:223 Species:Mus musculus


Alignment Length:224 Identity:76/224 - (33%)
Similarity:97/224 - (43%) Gaps:56/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 STTNTGHPSGCSLG-----GQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNAS------R 143
            |.|.|||....:.|     |.|.||.|    ....|.|::..|.:|..:|...:|:..      |
Mouse    18 SYTATGHAYAAARGPETTRGFGASGPG----GDLPAAPASRVPAATVESSGEQSGDEDEAFERRR 78

  Fly   144 RRKG---ALNA----KERNMRRLESNERERMRMHSLNDAFQSLREVIP--HVEMERRLSKIETLT 199
            ||:|   |::|    :|:...||..|.|||.|||.||||...||.|||  |....|:||||.||.
Mouse    79 RRRGSGVAVDARRRPREQRSLRLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSKIATLL 143

  Fly   200 LAKNYIINLTHIILSKRNEEAAALE--------LNSGAVGGVLLSNLSSESGGPVASG-IPANSN 255
            ||||||:           .:|.|||        ||.|.  |:         ..|||:. :.....
Mouse   144 LAKNYIL-----------MQAQALEEMRRLVAYLNQGQ--GL---------AAPVAAAPLTPFGQ 186

  Fly   256 AATICFEDTLASGGAFD-CAILAATDGSL 283
            ||...|....|.|...| ||..:.:..:|
Mouse   187 AAIYPFSAGTALGPCPDKCATFSGSPSAL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 32/55 (58%)
Bhlhe23NP_542372.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..93 17/64 (27%)
HLH 104..158 CDD:197674 33/64 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.