DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and Neurod6

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_033847.1 Gene:Neurod6 / 11922 MGIID:106593 Length:337 Species:Mus musculus


Alignment Length:206 Identity:61/206 - (29%)
Similarity:80/206 - (38%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 NASRRRKGALNAK------ER-NMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIET 197
            |...||:|....|      || ..||.|:|.|||.|||.||||..:||:|:|.....::||||||
Mouse    71 NGLSRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIET 135

  Fly   198 LTLAKNYIINLTHIILSKRNEEAAALELNSGAVGGVLLSNLSSESGGPVASGIPANSNAATICFE 262
            |.||||||..|:.|:...:..:......|       |...||..:...||..:..|:.:.     
Mouse   136 LRLAKNYIWALSEILRIGKRPDLLTFVQN-------LCKGLSQPTTNLVAGCLQLNARSF----- 188

  Fly   263 DTLASGGAFDCAILAATDGSLLNAATVTTSPAMQSIQSQAIHLQTPMEQQQQQASHLPHHQQAM- 326
             .:..||               .||..|.||                    ....:.|:|...: 
Mouse   189 -LMGQGG---------------EAAHHTRSP--------------------YSTFYPPYHSPELA 217

  Fly   327 --HGHGHLGAS 335
              .|||.|..|
Mouse   218 TPPGHGTLDNS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 32/54 (59%)
Neurod6NP_033847.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..80 4/8 (50%)
Nuclear localization signal. /evidence=ECO:0000255 80..86 1/5 (20%)
bHLH_TS_NeuroD6_ATOH2 82..151 CDD:381565 36/68 (53%)
Neuro_bHLH 153..272 CDD:372170 21/124 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.