DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and OLIG1

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_620450.2 Gene:OLIG1 / 116448 HGNCID:16983 Length:271 Species:Homo sapiens


Alignment Length:295 Identity:79/295 - (26%)
Similarity:110/295 - (37%) Gaps:93/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 QLSNNTYDLEMTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPS---GRGRVQQASSG 119
            ||..:.|:|........|..:|....||....|||....|.......:.|:   |.|    ..||
Human    27 QLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPG----PGSG 87

  Fly   120 ACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQSLREVI- 183
            |.|               .|:|   |..|...:::.:|| :.|.|||.||..||.|..:||||| 
Human    88 AHP---------------GGSA---RPDAKEEQQQQLRR-KINSRERKRMQDLNLAMDALREVIL 133

  Fly   184 PHVEME------RRLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVGGVLLSNLSSES 242
            |:....      |:||||.||.||:|||:.|           .::|:....|:|         |.
Human   134 PYSAAHCQGAPGRKLSKIATLLLARNYILLL-----------GSSLQELRRALG---------EG 178

  Fly   243 GGPVA-----SGIPANSNAATICFEDTLASGGAFDCAILAATDGSLLNAATVTTSP-AMQSIQSQ 301
            .||.|     :|:|                       :|||..||:|.|......| |::..:..
Human   179 AGPAAPRLLLAGLP-----------------------LLAAAPGSVLLAPGAVGPPDALRPAKYL 220

  Fly   302 AIHLQTPMEQQQQQASHLPHHQQAMHGHGHLGASI 336
            ::.|..|           |..|.|:.|.|..|..:
Human   221 SLALDEP-----------PCGQFALPGGGAGGPGL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 29/60 (48%)
OLIG1NP_620450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..117 25/101 (25%)
HLH 107..164 CDD:278439 29/57 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.