DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and neurod6b

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001296772.1 Gene:neurod6b / 114415 ZFINID:ZDB-GENE-010608-2 Length:332 Species:Danio rerio


Alignment Length:146 Identity:52/146 - (35%)
Similarity:70/146 - (47%) Gaps:27/146 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 NASRRRKGALNAKER------NMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETL 198
            |...::||....|..      .|||.|:|.|||.|||.||||.:|||:|:|.....::|||||||
Zfish    71 NGLPKKKGPRKKKSEGRGDRVKMRRQEANARERSRMHGLNDALESLRKVVPCYSKTQKLSKIETL 135

  Fly   199 TLAKNYIINLTHIILSKRNEEAAAL---------ELNSGAVGGVLLSN----LSSESGGPVASGI 250
            .||||||..|:..:.:.:..:..|.         :..:..|.|.|..|    |:..:|....||.
Zfish   136 RLAKNYIWALSETLSAGKRPDLLAFVQTLCKGLSQPTTNLVAGCLQLNARNFLTDHNGDVSFSGR 200

  Fly   251 PA--------NSNAAT 258
            ||        |:..||
Zfish   201 PAYDSLYPYPNAEMAT 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 33/59 (56%)
neurod6bNP_001296772.1 HLH 92..150 CDD:238036 34/57 (60%)
Neuro_bHLH 152..271 CDD:289310 14/65 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.