DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and neurog2

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_002934289.2 Gene:neurog2 / 100493110 XenbaseID:XB-GENE-491040 Length:213 Species:Xenopus tropicalis


Alignment Length:197 Identity:58/197 - (29%)
Similarity:87/197 - (44%) Gaps:33/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTS---------SNSSNANGNASRRRKGALNAKE 153
            |.||:.    |......|..|......::|.|.:         .||..:..:..|.:.|....|.
 Frog    19 SPCSVS----SSHMSPAQTCSSDDEQLLSPTSPALMHLQAQEQENSPPSRRSRPRTKNGETVLKV 79

  Fly   154 RNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHII-LSKRN 217
            :..||:::|.|||.|||.||.|..|||||:|.:..:.:|:|||||..|.|||..|:..: |::..
 Frog    80 KKTRRIKANNRERNRMHHLNSALDSLREVLPSLPEDAKLTKIETLRFAYNYIWALSETLRLAEHG 144

  Fly   218 EEAAALELNSGAVGGVLLSNLSSESGGPVASGIPANSNAATICFEDTLASGGAFDCAILAATDGS 282
            ..|:.            ||.:|.:...|..|  |:.|     |.....:|.|:|..|..|::...
 Frog   145 SSAST------------LSPMSVQDSSPSQS--PSWS-----CSSSPSSSCGSFSPASPASSTSD 190

  Fly   283 LL 284
            :|
 Frog   191 ML 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 28/53 (53%)
neurog2XP_002934289.2 bHLH_TS_NGN2_ATOH4 74..142 CDD:381560 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.