DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dimm and bhlha15

DIOPT Version :9

Sequence 1:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_017952828.2 Gene:bhlha15 / 100485413 XenbaseID:XB-GENE-877127 Length:175 Species:Xenopus tropicalis


Alignment Length:144 Identity:64/144 - (44%)
Similarity:76/144 - (52%) Gaps:29/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QQASSGA----CPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNERERMRMHSLND 174
            |::||.|    |||  ................|::::...|.||.:.||||||||||.|||.||:
 Frog    22 QRSSSEAHLVKCPS--YKEKRKGEDEELVKLTSKKKRETANGKEHSTRRLESNERERQRMHKLNN 84

  Fly   175 AFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVGGVLLSNLS 239
            |||:||||||||..|::||||||||||||||..||..||                       |:|
 Frog    85 AFQALREVIPHVRAEKKLSKIETLTLAKNYINTLTATIL-----------------------NMS 126

  Fly   240 SESGGPVASGIPAN 253
            |....|...|.|||
 Frog   127 SGCAAPGQEGRPAN 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dimmNP_001260674.1 HLH 154..208 CDD:238036 41/53 (77%)
bhlha15XP_017952828.2 bHLH_SF 67..128 CDD:412148 47/83 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I8039
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005380
OrthoInspector 1 1.000 - - oto105181
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4537
SonicParanoid 1 1.000 - - X6113
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.040

Return to query results.
Submit another query.